Somatorelin
PMID 33125822 reports that all four men given Somatorelin had IGF-I and/or GH-2000 scores above their own thresholds (checked: 2026-08-26). The Swedish Research Council for Sport Science and the World Anti-Doping Agency funded the work. This was a human biomarker-detection study. It was not a treatment trial for a named condition.
What exactly is Somatorelin?
Somatorelin is full-length human growth hormone-releasing hormone. Its 44-residue sequence matches the GSRS base record.
| Identity field | Verified value |
|---|---|
| Register name | Somatorelin |
| Class | Growth hormone-releasing hormone, full 44-residue human sequence |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL |
| Register aliases | GHRH (1-44); GHRF; Esfarase |
| Other GSRS names | GHRH(1-44) AMIDE; GRF 1-44; somatoliberin; somatocrinin; SR-95228 |
| UNII | 4UR7N9Z9MM |
| Register CAS | 9034-39-3 |
| Other CAS in the same GSRS record | 83930-13-6 |
| Identity source | GSRS Somatorelin record, checked 2026-08-26 |
| Related register records | Sermorelin; Tesamorelin; CJC-1295; modified GRF 1-29 |
What did direct human studies measure?
The studies used Somatorelin by name or full-length human GHRH(1-44).
These tests asked how the body's GH system reacts. They did not test long-term care. Some found a clear rise in GH-linked markers. Other comparisons found no group difference.
| Primary record | Human sample | Measured finding | Funding and limit |
|---|---|---|---|
| PMID 33125822 | 4 men received Somatorelin | IGF-I and/or GH-2000 crossed each man's own threshold in 4 of 4. Hematology measures did not change. | Swedish Research Council for Sport Science and World Anti-Doping Agency. Detection study, not treatment. Checked 2026-08-26. |
| PMID 2989315 | 10 children | GHRH(1-44) caused significant GH rises comparable with two other stimulation tests. A second study condition enhanced the GHRH-linked release in all participants. | PubMed marks non-U.S. government research support but names no agency. Acute stimulation study. Checked 2026-08-26. |
| PMID 3123873 | 10 healthy people | Prior growth hormone reduced incremental GH area under the curve from 1,196 ± 183 to 380 ± 139 ng/mL×min; p<0.005. | RR-47, U.S. NCRR/NIH, plus non-U.S. government support. Short feedback study. Checked 2026-08-26. |
| PMID 2512339 | 10 people with hyperthyroidism; 6 with hypothyroidism | GH responses to GHRH(1-44) did not change significantly after thyroid status normalized. | PubMed marks non-U.S. government support but names no agency. Mechanistic study. Checked 2026-08-26. |
| PMID 11176962 | 17 people with Parkinson disease; 16 with multiple-system atrophy; 11 controls | Somatorelin-induced GH release did not differ significantly among the three groups. | PubMed lists no grant. Somatorelin was a diagnostic comparator. Checked 2026-08-26. |
The opened abstracts give no adverse-event rate. The four-man study reports no change in the measured blood-cell variables.
This is mechanistic and diagnostic evidence, not a long-term treatment program.
It does not establish therapeutic benefit.
What do current United States product records show?
| Exact search checked August 26, 2026 | Result | Boundary |
|---|---|---|
DailyMed: Somatorelin; Esfarase | No current label | Exact terms only |
openFDA Drugs@FDA: Somatorelin; Esfarase | No matching application | Does not settle another place or time |
What do the central EU and country fields show?
| Field | Current primary record |
|---|---|
| Evidence tier: B | Human administration studies exist. They are small and answer mechanism, stimulation, diagnostic, or detection questions rather than a named treatment indication. Checked 2026-08-26. |
Central EU status: unclear | EMA report generated August 26, 2026: 2,732 medicine rows; no Somatorelin, Esfarase, or somatoliberin row. Positive controls resolved. The central file does not cover every national authorization. |
Germany: doping_classified | DmMV 2023 annex names Somatorelin under growth hormone-releasing hormones (GHRH). This classification is separate from evidence tier and authorization. Checked 2026-08-26. |
Sweden: unclear | Product file dated August 26, 2026: 38,382 rows; no Somatorelin, Esfarase, or somatoliberin row. Positive controls: semaglutide 44, somatropin 132, teriparatide 18. This file result does not classify another represented product. |
When was Somatorelin first observed in circulation?
The register stores first_observed: null.
No dated circulation value is asserted on this page. The field remains empty rather than estimated.
What does the large submitted-vial study show?
| Submitted-vial paper | Result |
|---|---|
| 2026 preprint, DOI 10.20944/preprints202604.1748.v1 | Lists fourteen compounds; Somatorelin is absent. Checked 2026-08-26. |
| Somatorelin result | No identity, amount, purity, or endotoxin finding; no first-observation date. |